PDB entry 1yga

View 1yga on RCSB PDB site
Description: CRYSTAL STRUCTURE OF Saccharomyces cerevisiae YN9A PROTEIN, NEW YORK STRUCTURAL GENOMICS CONSORTIUM
Class: isomerase
Keywords: ALDOSE_1_EPIMERASE, SUGAR METABOLISM, PREDICTED, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, ISOMERASE
Deposited on 2005-01-04, released 2005-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical 37.9 kDa protein in BIO3-HXT17 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YN9A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ygaa_
  • Chain 'B':
    Compound: Hypothetical 37.9 kDa protein in BIO3-HXT17 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YN9A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ygab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ygaA (A:)
    msnsngdnkygvitigdekkfqatiaplgatlvdlkvngqsvvqgysnvqdyltdgnmmg
    atvgryanriakgvfslddgphkltvnncgntnhssisslnlkqykaspvenpskgvyvv
    efkllddhtqpnpnefpgdlevtvkytlnvaemtldmeyqaqlvrgdatpinmtnhsyfn
    lnkvkseksirgtevkvcsnkslevtegallptgkiierniatfdstkptvlhedtpvfd
    ctfiidankdlkttdsvsvnklvpvfkayhpeshikfevstteptvhlytgdnlcgkfvp
    rsgfavqqgryvdainrdewrgcvllkrgevytsktqykfdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ygaA (A:)
    dnkygvitigdekkfqatiaplgatlvdlkvngqsvvqgysnvqdyltdgnmmgatvgry
    anriakgvfslddgphkltvnncgntnhssisslnlkqykaspvenpskgvyvvefklld
    dhtqpnpnefpgdlevtvkytlnvaemtldmeyqaqlvrgdatpinmtnhsyfnlnkvks
    eksirgtevkvcsnkslevtegallptgkiierniatfdstkptvlhedtpvfdctfiid
    ankdlkttdsvsvnklvpvfkayhpeshikfevstteptvhlytgdnlcgkfvprsgfav
    qqgryvdainrdewrgcvllkrgevytsktqykfdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ygaB (B:)
    msnsngdnkygvitigdekkfqatiaplgatlvdlkvngqsvvqgysnvqdyltdgnmmg
    atvgryanriakgvfslddgphkltvnncgntnhssisslnlkqykaspvenpskgvyvv
    efkllddhtqpnpnefpgdlevtvkytlnvaemtldmeyqaqlvrgdatpinmtnhsyfn
    lnkvkseksirgtevkvcsnkslevtegallptgkiierniatfdstkptvlhedtpvfd
    ctfiidankdlkttdsvsvnklvpvfkayhpeshikfevstteptvhlytgdnlcgkfvp
    rsgfavqqgryvdainrdewrgcvllkrgevytsktqykfdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ygaB (B:)
    dnkygvitigdekkfqatiaplgatlvdlkvngqsvvqgysnvqdyltdgnmmgatvgry
    anriakgvfslddgphkltvnncgntnhssisslnlkqykaspvenpskgvyvvefklld
    dhtqpnpnefpgdlevtvkytlnvaemtldmeyqaqlvrgdatpinmtnhsyfnlnkvks
    eksirgtevkvcsnkslevtegallptgkiierniatfdstkptvlhedtpvfdctfiid
    ankdlkttdsvsvnklvpvfkayhpeshikfevstteptvhlytgdnlcgkfvprsgfav
    qqgryvdainrdewrgcvllkrgevytsktqykfdi