SCOPe 2.08: Structural Classification of Proteins

PDB entry 1yg8

View 1yg8 on RCSB PDB site
Description: The structure of a V6A variant of ClpP.
Class: hydrolase
Keywords: Endopeptidase Clp, Caseinolytic protease, Protease Ti, Heat shock protein F21.5, HYDROLASE
Deposited on 2005-01-04, released 2006-04-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.22
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8a_
Chain 'B':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8b_
Chain 'C':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8c_
Chain 'D':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8d_
Chain 'E':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8e_
Chain 'F':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8f_
Chain 'G':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8g_
Chain 'H':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8h_
Chain 'I':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8i_
Chain 'J':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8j_
Chain 'K':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8k_
Chain 'L':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8l_
Chain 'M':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8m_
Chain 'N':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8n_
Chain 'O':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8o_
Chain 'P':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8p_
Chain 'Q':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8q_
Chain 'R':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8r_
Chain 'S':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8s_
Chain 'T':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8t_
Chain 'U':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8u_
Chain 'V':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8v_
Chain 'W':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8w_
Chain 'X':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8x_
Chain 'Y':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8y_
Chain 'Z':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Domains in SCOPe 2.08: d1yg8z_
Chain 'a':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)
Chain 'b':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P19245 (Start-192)

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1yg8A (A:)
alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
eyglvdsilthrn