PDB entry 1yfk

View 1yfk on RCSB PDB site
Description: Crystal structure of human B type phosphoglycerate mutase
Class: isomerase, hydrolase
Keywords: alpha/beta, ISOMERASE, HYDROLASE
Deposited on 2005-01-02, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.216
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate mutase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yfka_
  • Chain 'B':
    Compound: phosphoglycerate mutase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yfkb_
  • Heterogens: CL, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yfkA (A:)
    maayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvq
    krairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsyd
    vppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkr
    vliaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeetvr
    kameavaaqgkakklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yfkA (A:)
    ayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqkr
    airtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydvp
    pppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrvl
    iaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeetvrka
    mea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yfkB (B:)
    maayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvq
    krairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsyd
    vppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkr
    vliaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeetvr
    kameavaaqgkakklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yfkB (B:)
    ayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqkr
    airtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydvp
    pppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrvl
    iaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeetvrka