PDB entry 1yfi

View 1yfi on RCSB PDB site
Description: Crystal Structure of restriction endonuclease MspI in complex with its cognate DNA in P212121 space group
Class: Hydrolase/DNA
Keywords: protein-DNA complex
Deposited on 2005-01-02, released 2006-01-10
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.226
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II restriction enzyme MspI
    Species: Moraxella sp.
    Gene: MSPIR
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1yfia1
  • Chain 'B':
    Compound: Type II restriction enzyme MspI
    Species: Moraxella sp.
    Gene: MSPIR
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1yfib1
  • Chain 'C':
    Compound: 5'-d(*cp*cp*cp*cp*cp*gp*gp*gp*gp*g)-3'
    Species:
    Gene:
  • Chain 'D':
    Compound: 5'-d(*cp*cp*cp*cp*cp*gp*gp*gp*gp*g)-3'
    Species:
    Gene:
  • Chain 'E':
    Compound: 5'-d(*cp*cp*cp*cp*cp*gp*gp*gp*gp*g)-3'
    Species:
    Gene:
  • Chain 'F':
    Compound: 5'-d(*cp*cp*cp*cp*cp*gp*gp*gp*gp*g)-3'
    Species:
    Gene:
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yfiA (A:)
    mrtellsklyddfgidqlphtqhgvtsdrlgklyekyildifkdieslkkyntnafpqek
    disskllkalnldldniidvsssdtdlgrtiaggspktdatirftfhnqssrlvplnikh
    sskkkvsiaeydvetictgvgisdgelkelirkhqndqsaklftpvqkqrltellepyre
    rfirwcvtlraeksegnilhpdllirfqvidreyvdvtikniddyvsdriaegskarkpg
    fgtglnwtyasgskakkmqfkg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yfiB (B:)
    mrtellsklyddfgidqlphtqhgvtsdrlgklyekyildifkdieslkkyntnafpqek
    disskllkalnldldniidvsssdtdlgrtiaggspktdatirftfhnqssrlvplnikh
    sskkkvsiaeydvetictgvgisdgelkelirkhqndqsaklftpvqkqrltellepyre
    rfirwcvtlraeksegnilhpdllirfqvidreyvdvtikniddyvsdriaegskarkpg
    fgtglnwtyasgskakkmqfkg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.