PDB entry 1yee

View 1yee on RCSB PDB site
Description: structure of a catalytic antibody, igg2a fab fragment (d2.5)
Deposited on 1997-04-15, released 1997-10-15
The last revision prior to the SCOP 1.65 freeze date was dated 1997-10-15, with a file datestamp of 1997-10-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.204
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yeeH (H:)
    evklqesgaelvrpgasvklscktsgyiftsywihwvkqraaaglewiariypgtgssyy
    nvkfkgkatltadkssstaymqlsslksddsavyfcvrwgfipvredyvldywgqgtlvt
    vssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl
    qsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yeeL (L:)
    divmtqspltlsvtigqpasisckssqsllysngktylswllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlkisrveaadlglyycvqgthfpytfgggtkleilradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec