PDB entry 1yed

View 1yed on RCSB PDB site
Description: structure of a catalytic antibody igg2a fab fragment (d2.4)
Deposited on 1997-04-15, released 1997-10-15
The last revision prior to the SCOP 1.57 freeze date was dated 1997-10-15, with a file datestamp of 1997-10-15.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.215
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yedA (A:)
    divmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrliylvskle
    sgvpdrftgsgsgtdftlkisrveaadlgvyycvqgthfpytfgggtkleilradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yedB (B:)
    avklqqsgpelvrpgtsvklscktsgyiftsywihwlkqssgqglewiariypgtggtyy
    nekfkgkatltadkssstaymqlsslksedsavyfctrwgfttvrenyyamdywgqgtlv
    tvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpav
    lqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yedH (H:)
    avklqqsgpelvrpgtsvklscktsgyiftsywihwlkqssgqglewiariypgtggtyy
    nekfkgkatltadkssstaymqlsslksedsavyfctrwgfttvrenyyamdywgqgtlv
    tvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpav
    lqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yedL (L:)
    divmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrliylvskle
    sgvpdrftgsgsgtdftlkisrveaadlgvyycvqgthfpytfgggtkleilradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec