PDB entry 1yec

View 1yec on RCSB PDB site
Description: structure of a catalytic antibody igg2a fab fragment (d2.3)
Deposited on 1997-04-15, released 1997-10-15
The last revision prior to the SCOP 1.65 freeze date was dated 1997-10-15, with a file datestamp of 1997-10-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yecH (H:)
    emqlqqsgaellrpgtsvklscktsgyiftsywihwvkqrsgqglewiariypgtgstyy
    nekfkgkatltadkssstaymqlstlksedsavyfctrwgfipvredyvmdywgqgtlvt
    vssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl
    qsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yecL (L:)
    divmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrlihlvskld
    sgvpdritgsgsgtdftlkisrveaadlgvyycvqgthfpytfgggtkleilrgdaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec