PDB entry 1yea

View 1yea on RCSB PDB site
Description: structure determination and analysis of yeast iso-2-cytochrome c and a composite mutant protein
Deposited on 1991-10-29, released 1993-10-31
The last revision prior to the SCOP 1.61 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1yea__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yea_ (-)
    akestgfkpgsakkgatlfktrcqqchtieeggpnkvgpnlhgifgrhsgqvkgysytda
    ninknvkwdedsmseyltnpkkyipgtkmafaglkkekdrndlitymtkaak