PDB entry 1ydc

View 1ydc on RCSB PDB site
Description: structural basis of inhibitor affinity to variants of human carbonic anhydrase II
Class: hydro-lyase
Keywords: hydro-lyase
Deposited on 1994-12-22, released 1995-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase II
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918
      • conflict (195)
    Domains in SCOPe 2.07: d1ydca_
  • Heterogens: ZN, HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ydcA (A:)
    shhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslriln
    nghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlv
    hwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdpr
    gllpesldywtypgsfttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmv
    dnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydcA (A:)
    wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
    afnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhwn
    tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
    pesldywtypgsfttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
    rpaqplknrqikasf