PDB entry 1yc7

View 1yc7 on RCSB PDB site
Description: cAbAn33 VHH fragment against VSG
Class: immune system
Keywords: antibody, camel antibody, IMMUNE SYSTEM
Deposited on 2004-12-22, released 2005-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.192
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-VSG immunoglobulin heavy chain variable domain cAbAn33
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • GB AAP22644
    Domains in SCOPe 2.07: d1yc7a1, d1yc7a2
  • Chain 'B':
    Compound: anti-VSG immunoglobulin heavy chain variable domain cAbAn33
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • GB AAP22644 (Start-117)
    Domains in SCOPe 2.07: d1yc7b1, d1yc7b2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yc7A (A:)
    dvqlvesgggsvqaggslrlscavsgstyspcttgwyrqapgkerewvssisspgtiyyq
    dsvkgrftisrdnakntvylqmnslqredtgmyycqiqcgvrsireywgqgtqvtvsshh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yc7A (A:)
    vqlvesgggsvqaggslrlscavsgstyspcttgwyrqapgkerewvssisspgtiyyqd
    svkgrftisrdnakntvylqmnslqredtgmyycqiqcgvrsireywgqgtqvtvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yc7B (B:)
    dvqlvesgggsvqaggslrlscavsgstyspcttgwyrqapgkerewvssisspgtiyyq
    dsvkgrftisrdnakntvylqmnslqredtgmyycqiqcgvrsireywgqgtqvtvsshh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yc7B (B:)
    vqlvesgggsvqaggslrlscavsgtyspcttgwyrqapgkerewvssisspgtiyyqds
    vkgrftisrdnakntvylqmnslqredtgmyycqiqcgvrsireywgqgtqvtvss