PDB entry 1ybh

View 1ybh on RCSB PDB site
Description: Crystal structure of Arabidopsis thaliana Acetohydroxyacid synthase In Complex With A Sulfonylurea Herbicide Chlorimuron Ethyl
Class: transferase
Keywords: Acetohydroxyacid synthase, acetolactate synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor, cysteine-s-dioxide, CHES
Deposited on 2004-12-20, released 2006-01-10
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.192
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetolactate synthase, chloroplast
    Species: Arabidopsis thaliana
    Gene: CSR 1.2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17597 (0-581)
      • modified residue (254)
    Domains in SCOP 1.73: d1ybha1, d1ybha2, d1ybha3
  • Heterogens: MG, CIE, NHE, FAD, P22, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ybhA (A:)
    tfisrfapdqprkgadilvealerqgvetvfaypggasmeihqaltrsssirnvlprheq
    ggvfaaegyarssgkpgiciatsgpgatnlvsgladalldsvplvaitgqvprrmigtda
    fqetpivevtrsitkhnylvmdvedipriieeafflatsgrpgpvlvdvpkdiqqqlaip
    nweqamrlpgymsrmpkppedshleqivrliseskkpvlyvgggclnssdelgrfveltg
    ipvastlmglgsypcddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleaf
    asrakivhididsaeigknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrneln
    vqkqkfplsfktfgeaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwl
    ssgglgamgfglpaaigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnn
    qhlgmvmqwedrfykanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreai
    qtmldtpgpylldvicphqehvlpmipsggtfndvitegdgrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybhA (A:)
    tfisrfapdqprkgadilvealerqgvetvfaypggasmeihqaltrsssirnvlprheq
    ggvfaaegyarssgkpgiciatsgpgatnlvsgladalldsvplvaitgqvprrmigtda
    fqetpivevtrsitkhnylvmdvedipriieeafflatsgrpgpvlvdvpkdiqqqlaip
    nweqamrlpgymsrmpkppedshleqivrliseskkpvlyvgggclnssdelgrfveltg
    ipvastlmglgsypcddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleaf
    asrakivhididsaeigknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrneln
    vqkqkfplsfktfgeaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwl
    ssgglgamgfglpaaigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnn
    qhlgmvmqwedrfykanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreai
    qtmldtpgpylldvicphqehvlpmipsggtfndvitegdgr