PDB entry 1yaz

View 1yaz on RCSB PDB site
Description: azide-bound yeast cu(ii)/zn superoxide dismutase room temperature (298k) structure
Deposited on 1998-12-23, released 2000-01-12
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-12, with a file datestamp of 2000-01-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.173
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1yaza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yazA (A:)
    vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
    gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
    agqddlgkgdteeslktgnagprpacgvigltn