PDB entry 1yav

View 1yav on RCSB PDB site
Description: Crystal structure of CBS domain-containing protein ykuL from Bacillus subtilis
Class: structural genomics, unknown function
Keywords: Cystathionine beta synthase (CBS) domain, Structural Genomics, Protein Structure Initiative, PSI, New York Structural GenomiX Research Consortium, NYSGXRC, T1655, Sulfur SAD Technique
Deposited on 2004-12-17, released 2004-12-28
The last revision prior to the SCOP 1.75 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.228
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein BSU14130
    Species: Bacillus subtilis
    Gene: ykuL
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yava3
  • Chain 'B':
    Compound: hypothetical protein BSU14130
    Species: Bacillus subtilis
    Gene: ykuL
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yavb3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yavA (A:)
    mslislqsdqlleatvgqfmieadkvahvqvgnnlehallvltktgytaipvldpsyrlh
    gligtnmimnsifgleriefekldqitveevmltdiprlhindpimkgfgmvinngfvcv
    endeqvfegiftrrvvlkelnkhirslnkeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yavA (A:)
    lleatvgqfmieadkvahvqvgnnlehallvltktgytaipvldpsyrlhgligtnmimn
    sifgleriefekldqitveevmltdiprlhindpimkgfgmvinngfvcvendeqvfegi
    ftrrvvlkelnkhi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yavB (B:)
    mslislqsdqlleatvgqfmieadkvahvqvgnnlehallvltktgytaipvldpsyrlh
    gligtnmimnsifgleriefekldqitveevmltdiprlhindpimkgfgmvinngfvcv
    endeqvfegiftrrvvlkelnkhirslnkeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yavB (B:)
    eatvgqfmieadkvahvqvgnnlehallvltktgytaipvldpsyrlhgligtnmimnsi
    fgleriefekldqitveevmltdiprlhindpimkgfgmvinngfvcvendeqvfegift
    rrvvlkelnkhirsl