PDB entry 1yau

View 1yau on RCSB PDB site
Description: Structure of Archeabacterial 20S proteasome- PA26 complex
Class: hydrolase/hydrolase activator
Keywords: proteasome 20S, PA26 proteasome activator 11S
Deposited on 2004-12-17, released 2005-07-26
The last revision prior to the SCOP 1.75 freeze date was dated 2005-07-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.18
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yaua1
  • Chain 'B':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yaub1
  • Chain 'C':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yauc1
  • Chain 'D':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yaud1
  • Chain 'E':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yaue1
  • Chain 'F':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yauf1
  • Chain 'G':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yaug1
  • Chain 'H':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yauh1
  • Chain 'I':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yaui1
  • Chain 'J':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yauj1
  • Chain 'K':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yauk1
  • Chain 'L':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yaul1
  • Chain 'M':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yaum1
  • Chain 'N':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yaun1
  • Chain 'O':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOP 1.75: d1yauo1
  • Chain 'P':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOP 1.75: d1yaup1
  • Chain 'Q':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOP 1.75: d1yauq1
  • Chain 'R':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOP 1.75: d1yaur1
  • Chain 'S':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOP 1.75: d1yaus1
  • Chain 'T':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOP 1.75: d1yaut1
  • Chain 'U':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOP 1.75: d1yauu1
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yauA (A:)
    mqqgqmaggraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauA (A:)
    itvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlid
    dyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrp
    ygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavt
    lgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yauB (B:)
    mqqgqmaggraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauB (B:)
    itvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlid
    dyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrp
    ygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavt
    lgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yauC (C:)
    mqqgqmaggraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauC (C:)
    itvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlid
    dyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrp
    ygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavt
    lgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yauD (D:)
    mqqgqmaggraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauD (D:)
    itvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlid
    dyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrp
    ygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavt
    lgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1yauE (E:)
    mqqgqmaggraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauE (E:)
    itvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlid
    dyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrp
    ygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavt
    lgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1yauF (F:)
    mqqgqmaggraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauF (F:)
    itvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlid
    dyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrp
    ygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavt
    lgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1yauG (G:)
    mqqgqmaggraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauG (G:)
    itvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlid
    dyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrp
    ygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavt
    lgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1yauH (H:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauH (H:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1yauI (I:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauI (I:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1yauJ (J:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauJ (J:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1yauK (K:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauK (K:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1yauL (L:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauL (L:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1yauM (M:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauM (M:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1yauN (N:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauN (N:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1yauO (O:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauO (O:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1yauP (P:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauP (P:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1yauQ (Q:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauQ (Q:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1yauR (R:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauR (R:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1yauS (S:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauS (S:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1yauT (T:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauT (T:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1yauU (U:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yauU (U:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs