PDB entry 1yar

View 1yar on RCSB PDB site
Description: Structure of Archeabacterial 20S proteasome mutant D9S- PA26 complex
Class: hydrolase/hydrolase activator
Keywords: proteasome 20S, PA26 proteasome activator 11S
Deposited on 2004-12-17, released 2005-07-26
The last revision prior to the SCOP 1.75 freeze date was dated 2005-07-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.182
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum
    Gene: psmA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yara1
  • Chain 'B':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum
    Gene: psmA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yarb1
  • Chain 'C':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum
    Gene: psmA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yarc1
  • Chain 'D':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum
    Gene: psmA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yard1
  • Chain 'E':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum
    Gene: psmA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yare1
  • Chain 'F':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum
    Gene: psmA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yarf1
  • Chain 'G':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum
    Gene: psmA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yarg1
  • Chain 'H':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum
    Gene: psmB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yarh1
  • Chain 'I':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum
    Gene: psmB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yari1
  • Chain 'J':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum
    Gene: psmB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yarj1
  • Chain 'K':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum
    Gene: psmB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yark1
  • Chain 'L':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum
    Gene: psmB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yarl1
  • Chain 'M':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum
    Gene: psmB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yarm1
  • Chain 'N':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum
    Gene: psmB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yarn1
  • Chain 'O':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOP 1.75: d1yaro1
  • Chain 'P':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOP 1.75: d1yarp1
  • Chain 'Q':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOP 1.75: d1yarq1
  • Chain 'R':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOP 1.75: d1yarr1
  • Chain 'S':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOP 1.75: d1yars1
  • Chain 'T':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOP 1.75: d1yart1
  • Chain 'U':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOP 1.75: d1yaru1
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yarA (A:)
    mqqgqmaysraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarA (A:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yarB (B:)
    mqqgqmaysraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarB (B:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yarC (C:)
    mqqgqmaysraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarC (C:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yarD (D:)
    mqqgqmaysraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarD (D:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1yarE (E:)
    mqqgqmaysraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarE (E:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1yarF (F:)
    mqqgqmaysraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarF (F:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1yarG (G:)
    mqqgqmaysraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarG (G:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1yarH (H:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarH (H:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1yarI (I:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarI (I:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1yarJ (J:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarJ (J:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1yarK (K:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarK (K:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1yarL (L:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarL (L:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1yarM (M:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarM (M:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1yarN (N:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarN (N:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1yarO (O:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarO (O:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1yarP (P:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarP (P:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1yarQ (Q:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarQ (Q:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1yarR (R:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarR (R:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1yarS (S:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarS (S:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1yarT (T:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarT (T:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1yarU (U:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yarU (U:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs