PDB entry 1yaq

View 1yaq on RCSB PDB site
Description: contribution of hydrophobic residues to the stability of human lysozyme: calorimetric studies and x-ray structural analysis of the five isoleucine to valine mutants
Deposited on 1995-09-29, released 1996-04-03
The last revision prior to the SCOP 1.61 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1yaq__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yaq_ (-)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdnvadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv