PDB entry 1yaj

View 1yaj on RCSB PDB site
Description: Crystal Structure of Human Liver Carboxylesterase in complex with benzil
Class: hydrolase
Keywords: Hydrolase, Carboxylesterase, Benzil, Inhibition
Deposited on 2004-12-17, released 2005-08-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.207
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CES1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1yaja1
  • Chain 'B':
    Compound: CES1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1yajb1
  • Chain 'C':
    Compound: CES1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1yajc1
  • Chain 'D':
    Compound: CES1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1yajd1
  • Chain 'E':
    Compound: CES1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1yaje1
  • Chain 'F':
    Compound: CES1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1yajf1
  • Chain 'G':
    Compound: CES1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1yajg1
  • Chain 'H':
    Compound: CES1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1yajh1
  • Chain 'I':
    Compound: CES1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1yaji1
  • Chain 'J':
    Compound: CES1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1yajj1
  • Chain 'K':
    Compound: CES1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1yajk1
  • Chain 'L':
    Compound: CES1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1yajl1
  • Heterogens: NAG, SIA, SO4, BEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yajA (A:)
    ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
    tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
    ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
    vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
    vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
    tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
    lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
    aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
    nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yajB (B:)
    ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
    tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
    ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
    vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
    vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
    tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
    lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
    aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
    nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yajC (C:)
    ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
    tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
    ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
    vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
    vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
    tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
    lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
    aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
    nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yajD (D:)
    ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
    tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
    ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
    vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
    vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
    tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
    lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
    aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
    nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yajE (E:)
    ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
    tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
    ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
    vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
    vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
    tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
    lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
    aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
    nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yajF (F:)
    ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
    tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
    ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
    vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
    vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
    tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
    lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
    aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
    nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yajG (G:)
    ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
    tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
    ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
    vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
    vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
    tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
    lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
    aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
    nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yajH (H:)
    ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
    tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
    ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
    vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
    vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
    tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
    lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
    aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
    nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yajI (I:)
    ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
    tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
    ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
    vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
    vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
    tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
    lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
    aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
    nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yajJ (J:)
    ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
    tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
    ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
    vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
    vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
    tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
    lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
    aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
    nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yajK (K:)
    ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
    tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
    ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
    vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
    vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
    tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
    lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
    aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
    nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yajL (L:)
    ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
    tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
    ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
    vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
    vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
    tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
    lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
    aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
    nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak