PDB entry 1ya7

View 1ya7 on RCSB PDB site
Description: Implications for interactions of proteasome with PAN and PA700 from the 1.9 A structure of a proteasome-11S activator complex
Class: hydrolase/hydrolase activator
Keywords: archaeal proteasome, PA26, copmlex, open gate, HYDROLASE-HYDROLASE ACTIVATOR COMPLEX
Deposited on 2004-12-17, released 2005-07-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.18
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ya7a_
  • Chain 'B':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ya7b_
  • Chain 'C':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ya7c_
  • Chain 'D':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ya7d_
  • Chain 'E':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ya7e_
  • Chain 'F':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ya7f_
  • Chain 'G':
    Compound: Proteasome alpha subunit
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ya7g_
  • Chain 'H':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ya7h_
  • Chain 'I':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ya7i_
  • Chain 'J':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ya7j_
  • Chain 'K':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ya7k_
  • Chain 'L':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ya7l_
  • Chain 'M':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ya7m_
  • Chain 'N':
    Compound: Proteasome beta subunit
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ya7n_
  • Chain 'O':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOPe 2.01: d1ya7o1
  • Chain 'P':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOPe 2.01: d1ya7p_
  • Chain 'Q':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOPe 2.01: d1ya7q_
  • Chain 'R':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOPe 2.01: d1ya7r_
  • Chain 'S':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOPe 2.01: d1ya7s_
  • Chain 'T':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOPe 2.01: d1ya7t_
  • Chain 'U':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • GB AAD50581 (Start-236)
      • variant (54)
    Domains in SCOPe 2.01: d1ya7u_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ya7A (A:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7A (A:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ya7B (B:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7B (B:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ya7C (C:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7C (C:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ya7D (D:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7D (D:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ya7E (E:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7E (E:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ya7F (F:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7F (F:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ya7G (G:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7G (G:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ya7H (H:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7H (H:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1ya7I (I:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7I (I:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ya7J (J:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7J (J:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1ya7K (K:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7K (K:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ya7L (L:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7L (L:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1ya7M (M:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7M (M:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1ya7N (N:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7N (N:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1ya7O (O:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7O (O:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1ya7P (P:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7P (P:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1ya7Q (Q:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7Q (Q:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1ya7R (R:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7R (R:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1ya7S (S:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7S (S:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1ya7T (T:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7T (T:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1ya7U (U:)
    mhhhhhhppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnst
    ygraqaekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavl
    kiideleiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggs
    qspslllelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya7U (U:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgsdhmvs