PDB entry 1ya3

View 1ya3 on RCSB PDB site
Description: Crystal structure of the human mineralocorticoid receptor ligand-binding domain bound to progesterone and harboring the S810L mutation responsible for a severe form of hypertension
Class: transcription
Keywords: mineralocorticoid receptor, steroid receptor, nuclear receptor transcription regulation, activating mutation, hypertension
Deposited on 2004-12-17, released 2005-05-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.237
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235
      • engineered (80)
    Domains in SCOPe 2.06: d1ya3a_
  • Chain 'B':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235
      • engineered (80)
    Domains in SCOPe 2.06: d1ya3b_
  • Chain 'C':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235
      • engineered (80)
    Domains in SCOPe 2.06: d1ya3c_
  • Heterogens: STR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ya3A (A:)
    ssraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpg
    fknlpledqitliqyswmcllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelc
    qgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtk
    apnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlp
    kvesgnakplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya3A (A:)
    spvmvleniepeivyagydtaenllstlnrlagkqmiqvvkwakvlpgfknlpledqitl
    iqyswmcllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqislqfvr
    lqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtswqrfyqltklld
    smhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakplyfh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ya3B (B:)
    ssraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpg
    fknlpledqitliqyswmcllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelc
    qgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtk
    apnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlp
    kvesgnakplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya3B (B:)
    pvmvleniepeivyadtaenllstlnrlagkqmiqvvkwakvlpgfknlpledqitliqy
    swmcllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqislqfvrlql
    tfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtswqrfyqltklldsmh
    dlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakplyfh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ya3C (C:)
    ssraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpg
    fknlpledqitliqyswmcllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelc
    qgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtk
    apnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlp
    kvesgnakplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya3C (C:)
    spvmvlenievyagydsdtaenllstlnrlagkqmiqvvkwakvlpgfknlpledqitli
    qyswmcllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqislqfvrl
    qltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtswqrfyqltkllds
    mhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakplyfh