PDB entry 1y9r

View 1y9r on RCSB PDB site
Description: Crystal structure of the human mineralocorticoid receptor ligand-binding domain bound to deoxycorticosterone and harboring the S810L mutation responsible for a severe form of hypertension
Class: transcription, ligand binding protein
Keywords: mineralocorticoid receptor; steroid receptor; nuclear recept; transcription regulation; activating mutation; hypertension, transcription, ligand binding protein
Deposited on 2004-12-16, released 2005-05-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.229
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235
      • engineered (80)
    Domains in SCOPe 2.06: d1y9ra_
  • Chain 'B':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235 (Start-254)
      • engineered (80)
    Domains in SCOPe 2.06: d1y9rb_
  • Heterogens: 1CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y9rA (A:)
    ssraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpg
    fknlpledqitliqyswmcllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelc
    qgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtk
    apnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlp
    kvesgnakplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9rA (A:)
    spvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlple
    dqitliqyswmcllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqis
    lqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtswqrfyql
    tklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakplyfhr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y9rB (B:)
    ssraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpg
    fknlpledqitliqyswmcllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelc
    qgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtk
    apnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlp
    kvesgnakplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9rB (B:)
    spvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlple
    dqitliqyswmcllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqis
    lqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtqrfyqltk
    lldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakplyfhrk