PDB entry 1y8t

View 1y8t on RCSB PDB site
Description: Crystal Structure of RV0983 from Mycobacterium tuberculosis- Proteolytically active form
Class: unknown function
Keywords: SERINE PROTEASE, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, UNKNOWN FUNCTION
Deposited on 2004-12-13, released 2005-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.229
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein Rv0983
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O53896
      • modified residue (20)
      • modified residue (175)
    Domains in SCOPe 2.06: d1y8ta1, d1y8ta2
  • Chain 'B':
    Compound: hypothetical protein Rv0983
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O53896
      • modified residue (20)
      • modified residue (175)
    Domains in SCOPe 2.06: d1y8tb1, d1y8tb2
  • Chain 'C':
    Compound: hypothetical protein Rv0983
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O53896
      • modified residue (20)
      • modified residue (175)
    Domains in SCOPe 2.06: d1y8tc1, d1y8tc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y8tA (A:)
    anmppgsveqvaakvvpsvvmletdlgrqseegsgiilsaegliltnnhviaaaakpplg
    spppkttvtfsdgrtapftvvgadptsdiavvrvqgvsgltpislgsssdlrvgqpvlai
    gsplglegtvttgivsalnrpvsttgeagnqntvldaiqtdaainpgnsggalvnmnaql
    vgvnsaiatlgadsadaqsgsiglgfaipvdqakriadelistgkashaslgvqvtndkd
    tlgakivevvaggaaanagvpkgvvvtkvddrpinsadalvaavrskapgatvaltfqdp
    sggsrtvqvtlgkaeqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y8tA (A:)
    gsveqvaakvvpsvvmletdleegsgiilsaegliltnnhviaaaapkttvtfsdgrtap
    ftvvgadptsdiavvrvqgvsgltpislgsssdlrvgqpvlaigsplglegtvttgivsa
    lnrpvstntvldaiqtdaainpgnsggalvnmnaqlvgvnsaiatlqsgsiglgfaipvd
    qakriadelistgkashaslgvqvtndkdtlgakivevvaggaaanagvpkgvvvtkvdd
    rpinsadalvaavrskapgatvaltfqdpsggsrtvqvtlgka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y8tB (B:)
    anmppgsveqvaakvvpsvvmletdlgrqseegsgiilsaegliltnnhviaaaakpplg
    spppkttvtfsdgrtapftvvgadptsdiavvrvqgvsgltpislgsssdlrvgqpvlai
    gsplglegtvttgivsalnrpvsttgeagnqntvldaiqtdaainpgnsggalvnmnaql
    vgvnsaiatlgadsadaqsgsiglgfaipvdqakriadelistgkashaslgvqvtndkd
    tlgakivevvaggaaanagvpkgvvvtkvddrpinsadalvaavrskapgatvaltfqdp
    sggsrtvqvtlgkaeqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y8tB (B:)
    gsveqvaakvvpsvvmletdseegsgiilsaegliltnnhviaaapkttvtfsdgrtapf
    tvvgadptsdiavvrvqgvsgltpislgsssdlrvgqpvlaigsplglegtvttgivsal
    nrpvstntvldaiqtdaainpgnsggalvnmnaqlvgvnsaiatlgaqsgsiglgfaipv
    dqakriadelistgkashaslgvqvtndkgakivevvaggaaanagvpkgvvvtkvddrp
    insadalvaavrskapgatvalttvqvtlgka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y8tC (C:)
    anmppgsveqvaakvvpsvvmletdlgrqseegsgiilsaegliltnnhviaaaakpplg
    spppkttvtfsdgrtapftvvgadptsdiavvrvqgvsgltpislgsssdlrvgqpvlai
    gsplglegtvttgivsalnrpvsttgeagnqntvldaiqtdaainpgnsggalvnmnaql
    vgvnsaiatlgadsadaqsgsiglgfaipvdqakriadelistgkashaslgvqvtndkd
    tlgakivevvaggaaanagvpkgvvvtkvddrpinsadalvaavrskapgatvaltfqdp
    sggsrtvqvtlgkaeqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y8tC (C:)
    gsveqvaakvvpsvvmletdeegsgiilsaegliltnnhviaaaakpppkttvtfsdgrt
    apftvvgadptsdiavvrvqgvsgltpislgsssdlrvgqpvlaigsplglegtvttgiv
    salnrpvstqntvldaiqtdaainpgnsggalvnmnaqlvgvnsaiatlsgsiglgfaip
    vdqakriadelistgkashaslgvqvtnlgakivevgaavpkgvvvtkvdrpinsadalv
    aavrskapgaalgka