PDB entry 1y8r
View 1y8r on RCSB PDB site
Description: sumo e1 activating enzyme sae1-sae2-sumo1-mg-ATP complex
Class: ligase
Keywords: sumo; e1; heterodimer; activating enzyme; ubl, ligase
Deposited on
2004-12-13, released
2005-01-25
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.22
AEROSPACI score: 0.25
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Ubiquitin-like 1 activating enzyme E1A
Species: Homo sapiens [TaxId:9606]
Gene: UBLE1A, SAE1
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Ubiquitin-like 2 activating enzyme E1B
Species: Homo sapiens [TaxId:9606]
Gene: UBLE1B, SAE2
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Ubiquitin-like protein SMT3C
Species: Homo sapiens [TaxId:9606]
Gene: UBL1, SUMO-1, SMT3C, SMT3H3
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1y8rc_ - Chain 'D':
Compound: Ubiquitin-like 1 activating enzyme E1A
Species: Homo sapiens [TaxId:9606]
Gene: UBLE1A, SAE1
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: Ubiquitin-like 2 activating enzyme E1B
Species: Homo sapiens [TaxId:9606]
Gene: UBLE1B, SAE2
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: Ubiquitin-like protein SMT3C
Species: Homo sapiens [TaxId:9606]
Gene: UBL1, SUMO-1, SMT3C, SMT3H3
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1y8rf_ - Heterogens: MG, ZN, ATP, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>1y8rC (C:)
msdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmn
slrflfegqriadnhtpkelgmeeedvievyqeqtgg
Sequence, based on observed residues (ATOM records): (download)
>1y8rC (C:)
gdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriad
nhtpkelgmeeedvievyqeqtgg
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'F':
Sequence, based on SEQRES records: (download)
>1y8rF (F:)
msdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmn
slrflfegqriadnhtpkelgmeeedvievyqeqtgg
Sequence, based on observed residues (ATOM records): (download)
>1y8rF (F:)
gdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriad
nhtpkelgmeeedvievyqeqtgg