PDB entry 1y8r

View 1y8r on RCSB PDB site
Description: sumo e1 activating enzyme sae1-sae2-sumo1-mg-ATP complex
Class: ligase
Keywords: sumo; e1; heterodimer; activating enzyme; ubl, ligase
Deposited on 2004-12-13, released 2005-01-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.22
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like 1 activating enzyme E1A
    Species: Homo sapiens [TaxId:9606]
    Gene: UBLE1A, SAE1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ubiquitin-like 2 activating enzyme E1B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBLE1B, SAE2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBT2
      • engineered (172)
  • Chain 'C':
    Compound: Ubiquitin-like protein SMT3C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBL1, SUMO-1, SMT3C, SMT3H3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1y8rc_
  • Chain 'D':
    Compound: Ubiquitin-like 1 activating enzyme E1A
    Species: Homo sapiens [TaxId:9606]
    Gene: UBLE1A, SAE1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Ubiquitin-like 2 activating enzyme E1B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBLE1B, SAE2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBT2
      • engineered (172)
  • Chain 'F':
    Compound: Ubiquitin-like protein SMT3C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBL1, SUMO-1, SMT3C, SMT3H3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1y8rf_
  • Heterogens: MG, ZN, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y8rC (C:)
    msdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmn
    slrflfegqriadnhtpkelgmeeedvievyqeqtgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y8rC (C:)
    gdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriad
    nhtpkelgmeeedvievyqeqtgg
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1y8rF (F:)
    msdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmn
    slrflfegqriadnhtpkelgmeeedvievyqeqtgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y8rF (F:)
    gdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriad
    nhtpkelgmeeedvievyqeqtgg