PDB entry 1y7e

View 1y7e on RCSB PDB site
Description: the crystal structure of aminopeptidase i from borrelia burgdorferi b31
Deposited on 2004-12-08, released 2005-01-04
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-04, with a file datestamp of 2005-01-04.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.202
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y7eA (A:)
    mkkqnpwiylneeeknqilnfsesykkfiskfkterevtayaldkakklgfinaeekknl
    mpgdkifytcreksvafaiigknpiedgmnfivshtdsprldakpspiseeneltfiktn
    yyggikkyqwlstplsirgvvflkngekveinigdnendpvfvipdilphldrkiqrnkk
    sdeivegenlkiligslpietkeknkvklatlqlikekykieeedfvsseieivpagtak
    dvgfdkaligaygqddkicvftslesifdleetpnktaicflvdkeeigstgstgldsry
    leyfvsdmifkikkseynnlhvqkalwnsksisadvcaainplfssvhdeqnapqlgygi
    pimkytghggksmasdadaelvsyirqllnknniawqvatlgkveeggggtvakflagyg
    irtidmgpavismhspmeitskfdlynaylaykafyre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7eA (A:)
    qnpwiylneeeknqilnfsesykkfiskfkterevtayaldkakklgfinaeekknlmpg
    dkifytcreksvafaiigknpiedgmnfivshtdsprldakpspiseeneltfiktnyyg
    gikkyqwlstplsirgvvflkngekveinigdnendpvfvipdilnlkiligslpietke
    knkvklatlqlikekykieeedfvsseieivpagtakdvgfdkaligaygqddkicvfts
    lesifdleetpnktaicflvdkeeidsryleyfvsdmifkikkseynnlhvqkalwnsks
    isadvcaainpeqnapqlgygipimkytdaelvsyirqllnknniawqvatlgkggtvak
    flagygirtidmgpavismhspmeitskfdlynaylaykafyre