PDB entry 1y6w

View 1y6w on RCSB PDB site
Description: Trapped intermediate of calmodulin
Class: Calcium-Binding Protein
Keywords: EF-hand, calcium-binding protein, engineered disulfide
Deposited on 2004-12-07, released 2005-03-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Homo sapiens [TaxId:9606]
    Gene: calm1, calm2, calm3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62158
      • modified residue (35)
      • engineered (40)
      • modified residue (50)
      • engineered (63)
      • modified residue (70-71)
      • engineered (74)
      • modified residue (75)
      • modified residue (108)
      • modified residue (123)
      • modified residue (143-144)
    Domains in SCOPe 2.06: d1y6wa_
  • Heterogens: CA, MPD, TBU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y6wA (A:)
    adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgcnpteaelqdminevdadgn
    gtinfpefltmmarcmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdee
    vdemireadidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y6wA (A:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgcnpteaelqdminevdadgngt
    infpefltmmarcmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    emireadidgdgqvnyeefvqmmta