PDB entry 1y6j

View 1y6j on RCSB PDB site
Description: L-Lactate Dehydrogenase from Clostridium Thermocellum Cth-1135
Class: oxidoreductase
Keywords: L-Lactate Dehydrogenase, CLOSTRIDIUM THERMOCELLUM, SOUTHEAST COLLABORATORY FOR STRUCTURAL GENOMICS, SECSG, PROTEIN STRUCTURE INITIATIVE, PSI, OXIDOREDUCTASE
Deposited on 2004-12-06, released 2004-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: 0.229
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: Cth-1135
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00312075
    Domains in SCOPe 2.06: d1y6ja1, d1y6ja2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y6jA (A:)
    memvksrskvaiigagfvgasaaftmalrqtanelvlidvfkekaigeamdinhglpfmg
    qmslyagdysdvkdcdvivvtaganrkpgetrldlakknvmiakevtqnimkyynhgvil
    vvsnpvdiitymiqkwsglpvgkvigsgtvldsirfryllseklgvdvknvhgyiigehg
    dsqlplwscthiagknineyiddpkcnfteedkkkiaedvktagatiiknkgatyygiav
    sintivetllknqntirtvgtvingmygiedvaislpsivnsegvqevlqfnltpeeeea
    lrfsaeqvkkvlnevknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y6jA (A:)
    rskvaiigagfvgasaaftmalrqtanelvlidvfaigeamdinhglpfmgqmslydysd
    vkdcdvivvtagatrldlakknvmiakevtqnimkyynhgvilvvsnpvdiitymiqkws
    glpvgkvigsgtvldsirfryllseklgvdvknvhgyiigehgdsqlplwscthiagkni
    neydkkkiaedvktagatiiknkgatyygiavsintivetllknqntirtvgtvingmyg
    iedvaislpsivnsegvqevlqfnltpeeeealrfsaeqvkkvlnevkn