PDB entry 1y5r

View 1y5r on RCSB PDB site
Description: The crystal structure of murine 11b-hydroxysteroid dehydrogenase complexed with corticosterone
Class: oxidoreductase
Keywords: corticosterone bound, OXIDOREDUCTASE
Deposited on 2004-12-02, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.21
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Corticosteroid 11-beta-dehydrogenase, isozyme 1
    Species: Mus musculus [TaxId:10090]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y5ra_
  • Chain 'B':
    Compound: Corticosteroid 11-beta-dehydrogenase, isozyme 1
    Species: Mus musculus [TaxId:10090]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y5rb_
  • Heterogens: NDP, C0R

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y5rA (A:)
    mhhhhhhneefrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvs
    rclelgaasahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsv
    rrvmevnflsyvvmstaalpmlkqsngsiavisslagkmtqpmiapysaskfaldgffst
    irtelyitkvnvsitlcvlglidtetamkeisgiinaqaspkeecaleiikgtalrksev
    yydkspltpillgnpgrkimeffslryynkdmfvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y5rA (A:)
    eefrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvsrclelgaa
    sahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsvrrvmevnf
    lsyvvmstaalpmlkqsngsiavisslagkmtqpmiapysaskfaldgffstirtelyit
    kvnvsitlcvlglidtetamkeisgiinaqaspkeecaleiikgtalrksevyydksplt
    pillgnpgrkimeffslryynkdmf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y5rB (B:)
    mhhhhhhneefrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvs
    rclelgaasahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsv
    rrvmevnflsyvvmstaalpmlkqsngsiavisslagkmtqpmiapysaskfaldgffst
    irtelyitkvnvsitlcvlglidtetamkeisgiinaqaspkeecaleiikgtalrksev
    yydkspltpillgnpgrkimeffslryynkdmfvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y5rB (B:)
    eefrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvsrclelgaa
    sahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsvrrvmevnf
    lsyvvmstaalpmlkqsngsiavisslagkmtqpmiapysaskfaldgffstirtelyit
    kvnvsitlcvlglidtetamkeisgiinaqaspkeecaleiikgtalrksevyydksplt
    pillgnpgrkimeffslryynkdmf