PDB entry 1y5m

View 1y5m on RCSB PDB site
Description: The crystal structure of murine 11b-hydroxysteroid dehydrogenase: an important therapeutic target for diabetes
Class: oxidoreductase
Keywords: rossmann fold
Deposited on 2004-12-02, released 2005-05-17
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Corticosteroid 11-beta-dehydrogenase, isozyme 1
    Species: MUS MUSCULUS
    Gene: Hsd11b1, Hsd11
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1y5ma1
  • Chain 'B':
    Compound: Corticosteroid 11-beta-dehydrogenase, isozyme 1
    Species: MUS MUSCULUS
    Gene: Hsd11b1, Hsd11
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1y5mb1
  • Heterogens: SO4, NDP, OCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y5mA (A:)
    mhhhhhhneefrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvs
    rclelgaasahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsv
    rrvmevnflsyvvmstaalpmlkqsngsiavisslagkmtqpmiapysaskfaldgffst
    irtelyitkvnvsitlcvlglidtetamkeisgiinaqaspkeecaleiikgtalrksev
    yydkspltpillgnpgrkimeffslryynkdmfvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y5mA (A:)
    eefrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvsrclelgaa
    sahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsvrrvmevnf
    lsyvvmstaalpmlkqsngsiavisslagkmtqpmiapysaskfaldgffstirtelyit
    kvnvsitlcvlglidtetamkeisgiinaqaspkeecaleiikgtalrksevyydksplt
    pillgnpgrkimeffslryynkdmf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y5mB (B:)
    mhhhhhhneefrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvs
    rclelgaasahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsv
    rrvmevnflsyvvmstaalpmlkqsngsiavisslagkmtqpmiapysaskfaldgffst
    irtelyitkvnvsitlcvlglidtetamkeisgiinaqaspkeecaleiikgtalrksev
    yydkspltpillgnpgrkimeffslryynkdmfvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y5mB (B:)
    eefrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvsrclelgaa
    sahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsvrrvmevnf
    lsyvvmstaalpmlkqsngsiavisslagkmtqpmiapysaskfaldgffstirtelyit
    kvnvsitlcvlglidtetamkeisgiinaqaspkeecaleiikgtalrksevyydksplt
    pillgnpgrkimeffslryynkdmf