PDB entry 1y57

View 1y57 on RCSB PDB site
Description: Structure of unphosphorylated c-Src in complex with an inhibitor
Class: transferase
Keywords: Kinase structure, SH3, SH2, TRANSFERASE
Deposited on 2004-12-02, released 2005-06-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Homo sapiens [TaxId:9606]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12931 (1-451)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d1y57a1, d1y57a2, d1y57a3
  • Heterogens: SO4, MPZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y57A (A:)
    mvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsd
    siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
    ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcptskpqtqglakdawe
    ipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrhek
    lvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmayvermn
    yvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalygrfti
    ksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrk
    epeerptfeylqafledyftstepqyqpgenl