PDB entry 1y38

View 1y38 on RCSB PDB site
Description: Crystal structure of the complex formed between phospholipase A2 dimer and glycerophosphate at 2.4 A resolution
Class: hydrolase
Keywords: catalysis, inhibition, complex, HYDROLASE
Deposited on 2004-11-24, released 2005-05-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.194
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 VRV-PL-VIIIa
  Species: Daboia russellii pulchella [TaxId:97228]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59071 (0-120)
  Domains in SCOPe 2.01: d1y38a_
• Chain 'B':
  Compound: Phospholipase A2 VRV-PL-VIIIa
  Species: Daboia russellii pulchella [TaxId:97228]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59071 (0-120)
  Domains in SCOPe 2.01: d1y38b_
• Heterogens: NA, SO4, G3P, PGE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y38A (A:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y38B (B:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c