PDB entry 1y2m

View 1y2m on RCSB PDB site
Description: Crystal structure of phenylalanine ammonia-lyase from yeast Rhododporidium toruloides
Class: lyase
Keywords: Alpha helices, LYASE
Deposited on 2004-11-22, released 2005-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.159
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylalanine ammonia-lyase
    Species: Rhodosporidium toruloides [TaxId:5286]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11544
      • modified residue (50)
      • modified residue (168)
      • modified residue (249)
      • modified residue (277)
      • modified residue (287)
      • modified residue (298)
      • modified residue (303)
      • modified residue (421)
      • modified residue (442)
      • modified residue (447)
      • modified residue (496)
      • modified residue (563)
      • modified residue (713)
    Domains in SCOPe 2.07: d1y2ma_
  • Chain 'B':
    Compound: phenylalanine ammonia-lyase
    Species: Rhodosporidium toruloides [TaxId:5286]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11544 (Start-715)
      • modified residue (50)
      • modified residue (106)
      • modified residue (168)
      • modified residue (249)
      • modified residue (277)
      • modified residue (287)
      • modified residue (298)
      • modified residue (303)
      • modified residue (421)
      • modified residue (442)
      • modified residue (447)
      • modified residue (496)
      • modified residue (563)
      • modified residue (713)
    Domains in SCOPe 2.07: d1y2mb_
  • Chain 'C':
    Compound: phenylalanine ammonia-lyase
    Species: Rhodosporidium toruloides [TaxId:5286]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11544 (Start-715)
      • modified residue (50)
      • modified residue (168)
      • modified residue (249)
      • modified residue (277)
      • modified residue (287)
      • modified residue (298)
      • modified residue (303)
      • modified residue (421)
      • modified residue (442)
      • modified residue (447)
      • modified residue (496)
      • modified residue (563)
      • modified residue (713)
    Domains in SCOPe 2.07: d1y2mc_
  • Chain 'D':
    Compound: phenylalanine ammonia-lyase
    Species: Rhodosporidium toruloides [TaxId:5286]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11544 (Start-715)
      • modified residue (50)
      • modified residue (168)
      • modified residue (249)
      • modified residue (277)
      • modified residue (287)
      • modified residue (298)
      • modified residue (303)
      • modified residue (421)
      • modified residue (442)
      • modified residue (447)
      • modified residue (496)
      • modified residue (563)
      • modified residue (713)
    Domains in SCOPe 2.07: d1y2md_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y2mA (A:)
    mapsldsishsfangvasakqavngastnlavagshlpttqvtqvdivekmlaaptdstl
    eldgyslnlgdvvsaarkgrpvrvkdsdeirskidksveflrsqlsmsvygvttgfggsa
    dtrtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnsltrgh
    savrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvhegk
    ekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqsltamt
    veamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeevkvkddegilrq
    dryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavan
    tmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytse
    lghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlrai
    efefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhda
    fsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsp
    rtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y2mA (A:)
    astnlavagshlpttqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvk
    dsdeirskidksveflrtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvr
    gamtirvnsltrghsavrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaais
    ghpdskvhvvhegkekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhda
    hmlsllsqsltamtveamvghagsfhpflhdvtrphptqievagnirkllegsrfavhhe
    eevdegilrqdryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhg
    gnfqaaavantmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgl
    diaaaaytselghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlyc
    vlqaidlraiefefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtns
    ydlvprwhdafsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaast
    sspalsylsprtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnv
    llkml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y2mB (B:)
    mapsldsishsfangvasakqavngastnlavagshlpttqvtqvdivekmlaaptdstl
    eldgyslnlgdvvsaarkgrpvrvkdsdeirskidksveflrsqlsmsvygvttgfggsa
    dtrtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnsltrgh
    savrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvhegk
    ekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqsltamt
    veamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeevkvkddegilrq
    dryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavan
    tmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytse
    lghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlrai
    efefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhda
    fsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsp
    rtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y2mB (B:)
    astnlavagttqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvkdsde
    irskidksveflrsqlsmstedaislqkallehqlcgvlpssfdsfrlgrglenslplev
    vrgamtirvnsltrghsavrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaa
    isghpdskvhvvhegkekilyareamalfnlepvvlgpkeglglvngtavsasmatlalh
    dahmlsllsqsltamtveamvghagsfhpflhdvtrphptqievagnirkllegsrfavh
    heeevkdegilrqdryplrtspqwlgplvsdlihahavltieagqsttdnplidvenkts
    hhggnfqaaavantmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhc
    kgldiaaaaytselghlanpvtthvqpaemanqavnslalisarrttesndvlslllath
    lycvlqaidlraiefefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleq
    tnsydlvprwhdafsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsa
    astsspalsylsprtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgri
    nnvllkmla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y2mC (C:)
    mapsldsishsfangvasakqavngastnlavagshlpttqvtqvdivekmlaaptdstl
    eldgyslnlgdvvsaarkgrpvrvkdsdeirskidksveflrsqlsmsvygvttgfggsa
    dtrtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnsltrgh
    savrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvhegk
    ekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqsltamt
    veamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeevkvkddegilrq
    dryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavan
    tmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytse
    lghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlrai
    efefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhda
    fsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsp
    rtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y2mC (C:)
    astnlavagshlpttqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvk
    dsdeirskidksveflrsedaislqkallehqlcgvlpssfdsfrlgrglenslplevvr
    gamtirvnsltrghsavrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaais
    ghpdskvhvvhegkekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhda
    hmlsllsqsltamtveamvghagsfhpflhdvtrphptqievagnirkllegsrfavhhe
    edegilrqdryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggn
    fqaaavantmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldi
    aaaaytselghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvl
    qaidlraiefefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsyd
    lvprwhdafsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastss
    palsylsprtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvll
    kmla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y2mD (D:)
    mapsldsishsfangvasakqavngastnlavagshlpttqvtqvdivekmlaaptdstl
    eldgyslnlgdvvsaarkgrpvrvkdsdeirskidksveflrsqlsmsvygvttgfggsa
    dtrtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnsltrgh
    savrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvhegk
    ekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqsltamt
    veamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeevkvkddegilrq
    dryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavan
    tmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytse
    lghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlrai
    efefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhda
    fsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsp
    rtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y2mD (D:)
    astnlavttqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvkdsdeir
    skidksveflrstedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamti
    rvnsltrghsavrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpds
    kvhvvhegkekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsl
    lsqsltamtveamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeevde
    gilrqdryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqa
    aavantmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaa
    aytselghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqai
    dlraiefefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvp
    rwhdafsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspal
    sylsprtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkml
    a