PDB entry 1y1a

View 1y1a on RCSB PDB site
Description: crystal structure of calcium and integrin binding protein
Class: metal binding protein
Keywords: calcium-binding protein, integrin, ef-hand, glutathione, glutathiolation, metal binding protein
Deposited on 2004-11-17, released 2005-05-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.236
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium and integrin binding 1 (calmyrin)
    Species: Homo sapiens [TaxId:9606]
    Gene: CIB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1y1aa_
  • Chain 'B':
    Compound: Calcium and integrin binding 1 (calmyrin)
    Species: Homo sapiens [TaxId:9606]
    Gene: CIB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1y1ab_
  • Heterogens: CA, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y1aA (A:)
    skellaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanp
    fkericrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredl
    srlvncltgegedtrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfk
    ivl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y1aB (B:)
    skellaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanp
    fkericrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredl
    srlvncltgegedtrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfk
    ivl