PDB entry 1y0y

View 1y0y on RCSB PDB site
Description: Crystal structure of tetrahedral aminopeptidase from P. horikoshii in complex with amastatin
Class: hydrolase
Keywords: aminopeptidase, PDZ
Deposited on 2004-11-16, released 2005-03-01
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.206
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Frv operon protein FrvX
    Species: Pyrococcus horikoshii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1y0ya1, d1y0ya2
  • Heterogens: ZN, ATI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y0yA (A:)
    mevrnmvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahkkgeg
    pkvmiaahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasv
    pphiqkpedrkkapdwdqifidigaeskeeaedmgvkigtvitwdgrlerlgkhrfvsia
    fddriavytilevakqlkdakadvyfvatvqeevglrgartsafgiepdygfaidvtiaa
    dipgtpehkqvthlgkgtaikimdrsvichptivrwleelakkheipyqleillgggtda
    gaihltkagvptgalsvparyihsntevvderdvdatvelmtkalenihelki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0yA (A:)
    mvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahkkgegpkvmi
    aahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasapdwdq
    ifidigaeskeeaedmgvkigtvitwdgrlerlgkhrfvsiafddriavytilevakqlk
    dakadvyfvatvqeevglrgartsafgiepdygfaidvtiaadipgtpehkqvthlgkgt
    aikimdrsvichptivrwleelakkheipyqleillgggtdagaihltkagvptgalsvp
    aryihsntevvderdvdatvelmtkalenihelki