PDB entry 1y0y

View 1y0y on RCSB PDB site
Description: Crystal structure of tetrahedral aminopeptidase from P. horikoshii in complex with amastatin
Class: hydrolase/hydrolase inhibitor
Keywords: aminopeptidase, PDZ, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2004-11-16, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.206
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Frv operon protein FrvX
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y0ya1, d1y0ya3
  • Chain 'B':
    Compound: amastatin
    Species: Streptomyces sp. ME98-M3, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y0Y (0-3)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y0yA (A:)
    mevrnmvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahkkgeg
    pkvmiaahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasv
    pphiqkpedrkkapdwdqifidigaeskeeaedmgvkigtvitwdgrlerlgkhrfvsia
    fddriavytilevakqlkdakadvyfvatvqeevglrgartsafgiepdygfaidvtiaa
    dipgtpehkqvthlgkgtaikimdrsvichptivrwleelakkheipyqleillgggtda
    gaihltkagvptgalsvparyihsntevvderdvdatvelmtkalenihelki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0yA (A:)
    mvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahkkgegpkvmi
    aahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasapdwdq
    ifidigaeskeeaedmgvkigtvitwdgrlerlgkhrfvsiafddriavytilevakqlk
    dakadvyfvatvqeevglrgartsafgiepdygfaidvtiaadipgtpehkqvthlgkgt
    aikimdrsvichptivrwleelakkheipyqleillgggtdagaihltkagvptgalsvp
    aryihsntevvderdvdatvelmtkalenihelki
    

  • Chain 'B':
    No sequence available.