PDB entry 1y0v

View 1y0v on RCSB PDB site
Description: Crystal structure of anthrax edema factor (EF) in complex with calmodulin and pyrophosphate
Class: lyase
Keywords: Calcium-Independent, Calmodulin, Anthrax edema factor, LYASE
Deposited on 2004-11-16, released 2005-05-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: 0.286
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin-sensitive adenylate cyclase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: cya
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: calmodulin-sensitive adenylate cyclase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: cya
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: calmodulin-sensitive adenylate cyclase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: cya
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: calmodulin-sensitive adenylate cyclase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: cya
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: calmodulin-sensitive adenylate cyclase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: cya
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: calmodulin-sensitive adenylate cyclase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: cya
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: calmodulin
    Species: Xenopus laevis [TaxId:8355]
    Gene: calm1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62155 (2-145)
      • cloning artifact (0-1)
    Domains in SCOPe 2.02: d1y0vh1
  • Chain 'I':
    Compound: calmodulin
    Species: Xenopus laevis [TaxId:8355]
    Gene: calm1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62155 (2-145)
      • cloning artifact (0-1)
    Domains in SCOPe 2.02: d1y0vi1
  • Chain 'J':
    Compound: calmodulin
    Species: Xenopus laevis [TaxId:8355]
    Gene: calm1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62155 (2-145)
      • cloning artifact (0-1)
    Domains in SCOPe 2.02: d1y0vj1
  • Chain 'K':
    Compound: calmodulin
    Species: Xenopus laevis [TaxId:8355]
    Gene: calm1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62155 (2-145)
      • cloning artifact (0-1)
    Domains in SCOPe 2.02: d1y0vk1
  • Chain 'L':
    Compound: calmodulin
    Species: Xenopus laevis [TaxId:8355]
    Gene: calm1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62155 (2-145)
      • cloning artifact (0-1)
    Domains in SCOPe 2.02: d1y0vl1
  • Chain 'M':
    Compound: calmodulin
    Species: Xenopus laevis [TaxId:8355]
    Gene: calm1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62155 (2-145)
      • cloning artifact (0-1)
    Domains in SCOPe 2.02: d1y0vm1
  • Heterogens: MG, CA, POP

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y0vH (H:)
    aateeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    emireadidgdgqvnyeefvqmmtak
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y0vI (I:)
    aateeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    emireadidgdgqvnyeefvqmmtak
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y0vJ (J:)
    aateeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    emireadidgdgqvnyeefvqmmtak
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y0vK (K:)
    aateeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    emireadidgdgqvnyeefvqmmtak
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y0vL (L:)
    aateeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    emireadidgdgqvnyeefvqmmtak
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y0vM (M:)
    aateeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    emireadidgdgqvnyeefvqmmtak