PDB entry 1y0r

View 1y0r on RCSB PDB site
Description: Crystal structure of the tetrahedral aminopeptidase from P. horikoshii
Class: hydrolase
Keywords: Aminopeptidase domain, PDZ domain, HYDROLASE
Deposited on 2004-11-16, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.21
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Frv operon protein FrvX
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y0ra1, d1y0ra3
  • Heterogens: ZN, ARS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y0rA (A:)
    mevrnmvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahkkgeg
    pkvmiaahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasv
    pphiqkpedrkkapdwdqifidigaeskeeaedmgvkigtvitwdgrlerlgkhrfvsia
    fddriavytilevakqlkdakadvyfvatvqeevglrgartsafgiepdygfaidvtiaa
    dipgtpehkqvthlgkgtaikimdrsvichptivrwleelakkheipyqleillgggtda
    gaihltkagvptgalsvparyihsntevvderdvdatvelmtkalenihelki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0rA (A:)
    mvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahkkgegpkvmi
    aahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasapdwdq
    ifidigaeskeeaedmgvkigtvitwdgrlerlgkhrfvsiafddriavytilevakqlk
    dakadvyfvatvqeevglrgartsafgiepdygfaidvtiaadipgtpehkqvthlgkgt
    aikimdrsvichptivrwleelakkheipyqleillgggtdagaihltkagvptgalsvp
    aryihsntevvderdvdatvelmtkalenihel