PDB entry 1y0e

View 1y0e on RCSB PDB site
Description: Crystal structure of putative ManNAc-6-P epimerase from Staphylococcus aureus (strain N315)
Class: isomerase
Keywords: ManNAc-6-P epimerase, nanE, structural genomics, protein structure initiative, PSI, Midwest Center For Structural Genomics, MCSG, ISOMERASE
Deposited on 2004-11-15, released 2004-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.179
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative N-acetylmannosamine-6-phosphate 2-epimerase
    Species: Staphylococcus aureus [TaxId:158879]
    Gene: nanE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P65517 (1-End)
      • cloning artifact (0)
      • modified residue (1)
      • engineered (14)
      • modified residue (24)
      • modified residue (27)
      • modified residue (122)
      • modified residue (188)
      • modified residue (193)
      • modified residue (220)
    Domains in SCOPe 2.07: d1y0ea1, d1y0ea2
  • Chain 'B':
    Compound: Putative N-acetylmannosamine-6-phosphate 2-epimerase
    Species: Staphylococcus aureus [TaxId:158879]
    Gene: nanE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P65517 (1-End)
      • cloning artifact (0)
      • modified residue (1)
      • engineered (14)
      • modified residue (24)
      • modified residue (27)
      • modified residue (122)
      • modified residue (188)
      • modified residue (193)
      • modified residue (220)
    Domains in SCOPe 2.07: d1y0eb1, d1y0eb2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y0eA (A:)
    amlphglivscqalpdeplhssfimskmalaayeggavgirantkedilaiketvdlpvi
    givkrdydhsdvfitatskevdeliesqcevialdatlqqrpketldelvsyirthapnv
    eimadiatveeaknaarlgfdyigttlhgytsytqgqllyqndfqflkdvlqsvdakvia
    egnvitpdmykrvmdlgvhcsvvggaitrpkeitkrfvqvmed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0eA (A:)
    amlphglivscqalpdeplhssfimskmalaayeggavgirantkedilaiketvdlpvi
    givkrdydhsdvfitatskevdeliesqcevialdatlqqrpketldelvsyirthapnv
    eimadiatveeaknaarlgfdyigttlhgytsytqgqllyqndfqflkdvlqsvdakvia
    egnvitpdmykrvmdlgvhcsvvggaitrpkeitkrfvqvme
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y0eB (B:)
    amlphglivscqalpdeplhssfimskmalaayeggavgirantkedilaiketvdlpvi
    givkrdydhsdvfitatskevdeliesqcevialdatlqqrpketldelvsyirthapnv
    eimadiatveeaknaarlgfdyigttlhgytsytqgqllyqndfqflkdvlqsvdakvia
    egnvitpdmykrvmdlgvhcsvvggaitrpkeitkrfvqvmed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0eB (B:)
    amlphglivscqalpdeplhssfimskmalaayeggavgirantkedilaiketvdlpvi
    givkrdydhsdvfitatskevdeliesqcevialdatlqqrpketldelvsyirthapnv
    eimadiatveeaknaarlgfdyigttlhgytsytqgqllyqndfqflkdvlqsvdakvia
    egnvitpdmykrvmdlgvhcsvvggaitrpkeitkrfvqvme