PDB entry 1y08

View 1y08 on RCSB PDB site
Description: Structure of the Streptococcal Endopeptidase IdeS, a Novel Cysteine Proteinase with Strict Specificity for IgG
Class: hydrolase
Keywords: cysteine proteinase, papain-like fold with major insertions, hydrolase
Deposited on 2004-11-15, released 2004-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.196
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein SPy0861
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F1R7 (Start-322)
      • engineered (77)
    Domains in SCOPe 2.06: d1y08a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y08A (A:)
    mgsshhhhhhssglvprgshmirysevtpyhvtsvwtkgvtppanftqgedvfhapyvan
    qgwyditktfngkddllsgaatagnmlhwwfdqnkdqikryleehpekqkinfngeqmfd
    vkeaidtknhqldsklfeyfkekafpylstkhlgvfpdhvidmfingyrlsltnhgptpv
    kegskdprggifdavftrgdqsklltsrhdfkeknlkeisdlikkeltegkalglshtya
    nvrinhvinlwgadfdsngnlkaiyvtdsdsnasigmkkyfvgvnsagkvaisakeiked
    nigaqvlglftlstgqdswnqtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y08A (A:)
    tsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllsgaatagnmlhwwfd
    qnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafpylkhlg
    vfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqsklltsrhdfkek
    nlkeisdlikkeltegkalglshtyrinhvinlwgadfdsngnlkaiyvtdsdsnasigm
    kkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswnqtn