PDB entry 1xzl

View 1xzl on RCSB PDB site
Description: fusarium solani cutinase complex with n-hexylphosphonate ethyl ester
Deposited on 1995-11-28, released 1996-11-30
The last revision prior to the SCOP 1.67 freeze date was dated 1996-11-30, with a file datestamp of 1996-12-08.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.141
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1xzl__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1xzl_ (-)
    lptsnpaqelearqlerttrddlingnsascadvifiyargstetgnlgtlgpsiasnle
    safgkdgvwiqgvggayratlgdnalprgtssaairemlglfqqantkcpdatliaggys
    qgaalaaasiedldsairdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctg
    slivaaphlaygpdargpapefliekvravrgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xzl_ (-)
    rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
    yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
    irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpdar
    gpapefliekvravrgs