PDB entry 1xzj

View 1xzj on RCSB PDB site
Description: fusarium solani cutinase mutant with thr 38 replaced by phe
Deposited on 1995-11-28, released 1996-10-14
The last revision prior to the SCOP 1.67 freeze date was dated 1996-10-14, with a file datestamp of 1996-10-15.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.153
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1xzj__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1xzj_ (-)
    lptsnpaqelearqlerttrddlingnsascadvififargstetgnlgtlgpsiasnle
    safgkdgvwiqgvggayratlgdnalprgtssaairemlglfqqantkcpdatliaggys
    qgaalaaasiedldsairdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctg
    slivaaphlaygpdargpapefliekvravrgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xzj_ (-)
    rttrddlingnsascadvififargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
    yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
    irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpdar
    gpapefliekvravrgs