PDB entry 1xyg

View 1xyg on RCSB PDB site
Description: x-ray structure of gene product from arabidopsis thaliana at2g19940
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, Center for Eukaryotic Structural Genomics, CESG, AT2G19940, CATH 3.40.50 FOLD, SEMIALDEHYDE DEHYDORGENASE FAMILY, TETRAMER, OXIDOREDUCTASE
Deposited on 2004-11-09, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative N-acetyl-gamma-glutamyl-phosphate reductase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g19940
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xyga1, d1xyga2
  • Chain 'B':
    Compound: putative N-acetyl-gamma-glutamyl-phosphate reductase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g19940
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xygb1, d1xygb2
  • Chain 'C':
    Compound: putative N-acetyl-gamma-glutamyl-phosphate reductase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g19940
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xygc1, d1xygc2
  • Chain 'D':
    Compound: putative N-acetyl-gamma-glutamyl-phosphate reductase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g19940
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xygd1, d1xygd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xygA (A:)
    msfrvsasssvkpekdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesv
    fphlraqklptlvsvkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrni
    aeyeewygqphkavelqkevvyglteilredikkarlvanpgcypttiqlplvpllkanl
    ikheniiidaksgvsgagrgakeanlyseiaegissygvtrhrhvpeieqglsdvaqskv
    tvsftphlmpmirgmqstiyvemapgvrtedlhqqlktsyedeefvkvldegvvprthnv
    rgsnychmsvfpdripgraiiisvidnlvkgasgqalqnlnimlgypettgllhqplfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xygA (A:)
    kdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesvfphlraqklptlvs
    vkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrniaeyeewygqphkav
    elqkevvyglteilredikkarlvanpgcypttiqlplvpllkanlikheniiidaksgv
    sgagrgakeanlyseiaegissygvtrhrhvpeieqglsdvaqskvtvsftphlmpmirg
    mqstiyvemapgvrtedlhqqlktsyedeefvkvldegvvprthnvrgsnychmsvfpdr
    ipgraiiisvidnlvkgasgqalqnlnimlgypettgllhqplfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xygB (B:)
    msfrvsasssvkpekdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesv
    fphlraqklptlvsvkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrni
    aeyeewygqphkavelqkevvyglteilredikkarlvanpgcypttiqlplvpllkanl
    ikheniiidaksgvsgagrgakeanlyseiaegissygvtrhrhvpeieqglsdvaqskv
    tvsftphlmpmirgmqstiyvemapgvrtedlhqqlktsyedeefvkvldegvvprthnv
    rgsnychmsvfpdripgraiiisvidnlvkgasgqalqnlnimlgypettgllhqplfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xygB (B:)
    kdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesvfphlraqklptlvs
    vkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrniaeyeewygqphkav
    elqkevvyglteilredikkarlvanpgcypttiqlplvpllkanlikheniiidaksgv
    sgagrgakeanlyseiaegissygvtrhrhvpeieqglsdvaqskvtvsftphlmpmirg
    mqstiyvemapgvrtedlhqqlktsyedeefvkvldegvvprthnvrgsnychmsvfpdr
    ipgraiiisvidnlvkgasgqalqnlnimlgypettgllhqplfp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xygC (C:)
    msfrvsasssvkpekdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesv
    fphlraqklptlvsvkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrni
    aeyeewygqphkavelqkevvyglteilredikkarlvanpgcypttiqlplvpllkanl
    ikheniiidaksgvsgagrgakeanlyseiaegissygvtrhrhvpeieqglsdvaqskv
    tvsftphlmpmirgmqstiyvemapgvrtedlhqqlktsyedeefvkvldegvvprthnv
    rgsnychmsvfpdripgraiiisvidnlvkgasgqalqnlnimlgypettgllhqplfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xygC (C:)
    kdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesvfphlraqklptlvs
    vkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrniaeyeewygqphkav
    elqkevvyglteilredikkarlvanpgcypttiqlplvpllkanlikheniiidaksgv
    sgagrgakeanlyseiaegissygvtrhrhvpeieqglsdvaqskvtvsftphlmpmirg
    mqstiyvemapgvrtedlhqqlktsyedeefvkvldegvvprthnvrgsnychmsvfpdr
    ipgraiiisvidnlvkgasgqalqnlnimlgypettgllhqplfp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xygD (D:)
    msfrvsasssvkpekdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesv
    fphlraqklptlvsvkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrni
    aeyeewygqphkavelqkevvyglteilredikkarlvanpgcypttiqlplvpllkanl
    ikheniiidaksgvsgagrgakeanlyseiaegissygvtrhrhvpeieqglsdvaqskv
    tvsftphlmpmirgmqstiyvemapgvrtedlhqqlktsyedeefvkvldegvvprthnv
    rgsnychmsvfpdripgraiiisvidnlvkgasgqalqnlnimlgypettgllhqplfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xygD (D:)
    kdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesvfphlraqklptlvs
    vkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrniaeyeewygqphkav
    elqkevvyglteilredikkarlvanpgcypttiqlplvpllkanlikheniiidaksgv
    sgagrgakeanlyseiaegissygvtrhrhvpeieqglsdvaqskvtvsftphlmpmirg
    mqstiyvemapgvrtedlhqqlktsyedeefvkvldegvvprthnvrgsnychmsvfpdr
    ipgraiiisvidnlvkgasgqalqnlnimlgypettgllhqplfp