PDB entry 1xxw

View 1xxw on RCSB PDB site
Description: Structure of zinc induced heterodimer of two calcium free isoforms of phospholipase A2 from Naja naja sagittifera at 2.7A resolution
Class: hydrolase
Keywords: venom, esterolytic activity, zinc induced, dimer
Deposited on 2004-11-09, released 2005-03-15
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.188
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 isoform 1
    Species: Naja sagittifera
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xxwa1
  • Chain 'B':
    Compound: Phospholipase A2 isoform 2
    Species: Naja sagittifera
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xxwb1
  • Heterogens: ZN, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xxwA (A:)
    ntyqfknmiqctvpkrswwdfadygcycgrggsgtpiddldrccqvhdncynsareqggc
    rpkqktysyeckagtlscsgsnnscaatvcdcdrlaaicfagapyndnnynidlkarcq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xxwB (B:)
    nrwqfknmisctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
    nprfrtysyectagtltctgrnnacaasvcdcdrlaaicfagapyndnnynidlqarcn