PDB entry 1xxm

View 1xxm on RCSB PDB site
Description: The modular architecture of protein-protein binding site
Class: hydrolase/hydrolase inhibitor
Keywords: PROTEIN-PROTEIN COMPLEX; TEM-1 BETA-LACTAMASE; BETA-2 LACTAMASE INHIBITOR PROTEIN; BLIP, Israel Structural Proteomics Center, ISPC, Structural Genomics, HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on 2004-11-07, released 2005-01-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli [TaxId:562]
    Gene: bla
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-262)
      • engineered (58)
      • engineered (78-79)
    Domains in SCOPe 2.05: d1xxma_
  • Chain 'B':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli [TaxId:562]
    Gene: bla
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-262)
      • engineered (58)
      • engineered (78-79)
    Domains in SCOPe 2.05: d1xxmb_
  • Chain 'C':
    Compound: Beta-lactamase inhibitory protein
    Species: Streptomyces clavuligerus [TaxId:1901]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35804 (0-164)
      • engineered (73)
      • engineered (141-142)
    Domains in SCOPe 2.05: d1xxmc_
  • Chain 'D':
    Compound: Beta-lactamase inhibitory protein
    Species: Streptomyces clavuligerus [TaxId:1901]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35804 (0-164)
      • engineered (73)
      • engineered (141-142)
    Domains in SCOPe 2.05: d1xxmd_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xxmA (A:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrid
    agqeqlgrrihysqndlvaaspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xxmB (B:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrid
    agqeqlgrrihysqndlvaaspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xxmC (C:)
    agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgfts
    aaadakvdsksqeallapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypayp
    stagvtlslscfdvdgysstgaargsahlwftdgvlqgkrqwdlv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xxmD (D:)
    agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgfts
    aaadakvdsksqeallapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypayp
    stagvtlslscfdvdgysstgaargsahlwftdgvlqgkrqwdlv