PDB entry 1xx5

View 1xx5 on RCSB PDB site
Description: Crystal Structure of Natrin from Naja atra snake venom
Class: toxin
Keywords: Natrin, CRISPs, Naja atra, TOXIN
Deposited on 2004-11-04, released 2005-06-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-03, with a file datestamp of 2014-11-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.206
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Natrin 1
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xx5a1, d1xx5a2
  • Chain 'B':
    Compound: Natrin 1
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xx5b1, d1xx5b2
  • Chain 'C':
    Compound: Natrin 1
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xx5c1, d1xx5c2
  • Heterogens: EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xx5A (A:)
    nvdfnsestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnh
    spdnlrvlegiqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqiv
    wyqtyragcavsycpssawsyfyvcqycpsgnfqgktatpyklgppcgdcpsacdnglct
    npctiynkltncdsllkqsscqddwiksncpascfcrnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xx5A (A:)
    sestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnhspdnl
    rvlegiqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqivwyqty
    ragcavsycpssawsyfyvcqycpsgnfqgktatpyklgppcgdcpsacdnglctnpcti
    ynkltncdsllkqsscqddwiksncpascfcrnkii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xx5B (B:)
    nvdfnsestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnh
    spdnlrvlegiqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqiv
    wyqtyragcavsycpssawsyfyvcqycpsgnfqgktatpyklgppcgdcpsacdnglct
    npctiynkltncdsllkqsscqddwiksncpascfcrnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xx5B (B:)
    sestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnhspdnl
    rvlegiqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqivwyqty
    ragcavsycpssawsyfyvcqycpsgnfqgktatpyklgppcgdcpsacdnglctnpcti
    ynkltncdsllkqsscqddwiksncpascfcrnkii
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xx5C (C:)
    nvdfnsestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnh
    spdnlrvlegiqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqiv
    wyqtyragcavsycpssawsyfyvcqycpsgnfqgktatpyklgppcgdcpsacdnglct
    npctiynkltncdsllkqsscqddwiksncpascfcrnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xx5C (C:)
    rrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnhspdnlrvle
    giqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqivwyqtyragc
    avsycpssawsyfyvcqycpsgnfqgktatpyklgppcgdcpsacdnglctnpctiynkl
    tncdsllkqsscqddwiksncpascfcrnkii