PDB entry 1xx2

View 1xx2 on RCSB PDB site
Description: Refinement of P99 beta-lactamase from Enterobacter cloacae
Class: hydrolase
Keywords: CLASS C BETA-LACTAMASE, CEPHALOSPORINASE, PENICILLINASE, AMPC, ENTEROBACTER CLOACAE, ANTIBIOTIC RESISTANCE, SERINE HYDROLASE, hydrolase
Deposited on 2004-11-03, released 2004-11-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.175
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1xx2a_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1xx2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xx2A (A:)
    tpvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlf
    elgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglplq
    vpdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlk
    plkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmap
    envadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvae
    vnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xx2A (A:)
    pvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
    lgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglplqv
    pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
    lkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmape
    nvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvaev
    nppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xx2B (B:)
    tpvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlf
    elgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglplq
    vpdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlk
    plkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmap
    envadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvae
    vnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xx2B (B:)
    pvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
    lgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglplqv
    pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
    lkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmape
    nvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvaev
    nppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal