PDB entry 1xwd

View 1xwd on RCSB PDB site
Description: Crystal Structure of Human Follicle Stimulating Hormone Complexed with its Receptor
Class: Hormone/Growth Factor
Keywords: Hormone-receptor complex, Leucine-rich repeats, Cysteine-knot motif
Deposited on 2004-10-30, released 2005-01-25
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: 0.221
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoprotein hormones alpha chain
    Species: HOMO SAPIENS
    Gene: CGA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xwda1
  • Chain 'B':
    Compound: Follitropin beta chain
    Species: HOMO SAPIENS
    Gene: FSHB
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Follicle stimulating hormone receptor
    Species: HOMO SAPIENS
    Gene: FSHR
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Glycoprotein hormones alpha chain
    Species: HOMO SAPIENS
    Gene: CGA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xwdd1
  • Chain 'E':
    Compound: Follitropin beta chain
    Species: HOMO SAPIENS
    Gene: FSHB
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Follicle stimulating hormone receptor
    Species: HOMO SAPIENS
    Gene: FSHR
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xwdA (A:)
    apdvqdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestcc
    vaksynrvtvmggfkvenhtachcstcyyhks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwdA (A:)
    dvqdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestccva
    ksynrvtvmggfkvenhtachcstcyyhks
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xwdD (D:)
    apdvqdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestcc
    vaksynrvtvmggfkvenhtachcstcyyhks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwdD (D:)
    dcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestccvaksy
    nrvtvmggfkvenhtachcstcyyhks
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.