PDB entry 1xwa

View 1xwa on RCSB PDB site
Description: Drospohila thioredoxin, oxidized, P41212
Class: electron transport
Keywords: Dimerization, Drosophila melanogaster, redox regulation, thioredoxin, x-ray crystal structure, ELECTRON TRANSPORT
Deposited on 2004-10-29, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.226
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: TRX-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9V429 (5-110)
      • cloning artifact (0-4)
    Domains in SCOPe 2.07: d1xwaa1, d1xwaa2
  • Chain 'B':
    Compound: thioredoxin
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: TRX-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xwab_
  • Chain 'C':
    Compound: thioredoxin
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: TRX-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xwac_
  • Chain 'D':
    Compound: thioredoxin
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: TRX-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xwad_
  • Heterogens: CD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xwaA (A:)
    aaaaamvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvv
    lkvdvdecediameynissmptfvflkngvkveefaganakrledvikani
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xwaB (B:)
    aaaaamvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvv
    lkvdvdecediameynissmptfvflkngvkveefaganakrledvikani
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwaB (B:)
    mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
    decediameynissmptfvflkngvkveefaganakrledvikani
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xwaC (C:)
    aaaaamvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvv
    lkvdvdecediameynissmptfvflkngvkveefaganakrledvikani
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwaC (C:)
    mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
    decediameynissmptfvflkngvkveefaganakrledvikani
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xwaD (D:)
    aaaaamvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvv
    lkvdvdecediameynissmptfvflkngvkveefaganakrledvikani
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwaD (D:)
    mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
    decediameynissmptfvflkngvkveefaganakrledvikani