PDB entry 1xvy

View 1xvy on RCSB PDB site
Description: Crystal Structure of iron-free Serratia marcescens SfuA
Class: iron binding protein
Keywords: periplasmic iron binding protein
Deposited on 2004-10-28, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.165
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sfuA
    Species: Yersinia enterocolitica [TaxId:630]
    Gene: sfuA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xvya_
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xvyA (A:)
    dqgiviynaqhenlvkswvdgftkdtgikvtlrnggdselgnqlvqegsaspadvflten
    spamvlvdnaklfapldaatlaqvepqyrpshgrwigiaarstvfvynpaklsdaqlpks
    lldlakpewkgrwaaspsgadfqaivsallelkgekatlawlkamktnftaykgnstvmk
    avnagqvdsgviyhyypfvdgaktgensnniklyyfkhqdpgafvsisgggvlasskhqq
    qaqafikwitgkqgqeilrtnnafeyavgvgaasnpklvplkdldapkvdaaqlnskkvv
    elmteagll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvyA (A:)
    giviynaqhenlvkswvdgftkdtgikvtlrnggdselgnqlvqegsaspadvfltensp
    amvlvdnaklfapldaatlaqvepqyrpshgrwigiaarstvfvynpaklsdaqlpksll
    dlakpewkgrwaaspsgadfqaivsallelkgekatlawlkamktnftaykgnstvmkav
    nagqvdsgviyhyypfvdgaktgensnniklyyfkhqdpgafvsisgggvlasskhqqqa
    qafikwitgkqgqeilrtnnafeyavgvgaasnpklvplkdldapkvdaaqlnskkvvel
    mteagll