PDB entry 1xvj

View 1xvj on RCSB PDB site
Description: Crystal Structure Of Rat alpha-Parvalbumin D94S/G98E Mutant
Class: metal binding protein
Keywords: parvalbumin, calcium-binding protein, EF hand protein, METAL BINDING PROTEIN
Deposited on 2004-10-28, released 2005-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: parvalbumin alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PVALB, PVA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02625 (0-108)
      • engineered (93)
      • engineered (97)
    Domains in SCOPe 2.08: d1xvja_
  • Chain 'B':
    Compound: parvalbumin alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PVALB, PVA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02625 (0-108)
      • engineered (93)
      • engineered (97)
    Domains in SCOPe 2.08: d1xvjb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xvjA (A:)
    smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
    delgsilkgfssdardlsaketktlmaagdkdgsgkieveefstlvaes
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xvjB (B:)
    smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
    delgsilkgfssdardlsaketktlmaagdkdgsgkieveefstlvaes