PDB entry 1xvg

View 1xvg on RCSB PDB site
Description: soluble methane monooxygenase hydroxylase: bromoethanol soaked structure
Class: oxidoreductase
Keywords: methane, diiron, product binding, cavities, four-helix bundle, OXIDOREDUCTASE
Deposited on 2004-10-27, released 2005-05-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.198
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methane monooxygenase component A alpha chain
    Species: Methylococcus capsulatus [TaxId:414]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1xvga1
  • Chain 'B':
    Compound: Methane monooxygenase component A alpha chain
    Species: Methylococcus capsulatus [TaxId:414]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1xvgb1
  • Chain 'C':
    Compound: Methane monooxygenase component A beta chain
    Species: Methylococcus capsulatus [TaxId:414]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1xvgc_
  • Chain 'D':
    Compound: Methane monooxygenase component A beta chain
    Species: Methylococcus capsulatus [TaxId:414]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1xvgd_
  • Chain 'E':
    Compound: Methane monooxygenase component A gamma chain
    Species: Methylococcus capsulatus [TaxId:414]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1xvge_
  • Chain 'F':
    Compound: Methane monooxygenase component A gamma chain
    Species: Methylococcus capsulatus [TaxId:414]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1xvgf_
  • Heterogens: FE, CA, BRJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xvgA (A:)
    malstatkaatdalaanraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqf
    kliakeyarmeavkderqfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaa
    tgmlwdsaqaaeqkngylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigpl
    wkgmkrvfsdgfisgdavecslnlqlvgeacftnplivavtewaaangdeitptvflsie
    tdelrhmangyqtvvsiandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvep
    wvktwdrwvyedwggiwigrlgkygvesprslkdakqdaywahhdlyllayalwptgffr
    lalpdqeemewfeanypgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrv
    sqvpfcpslakgastlrvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelse
    viaelhglrsdgktliaqphvrgdklwtlddikrlncvfknpvkafn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvgA (A:)
    raptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkder
    qfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkngy
    laqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgda
    vecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvsi
    andpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggiw
    igrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeanyp
    gwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastlr
    vheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktlia
    qphvrgdklwtlddikrlncvfknpvkafn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xvgB (B:)
    malstatkaatdalaanraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqf
    kliakeyarmeavkderqfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaa
    tgmlwdsaqaaeqkngylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigpl
    wkgmkrvfsdgfisgdavecslnlqlvgeacftnplivavtewaaangdeitptvflsie
    tdelrhmangyqtvvsiandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvep
    wvktwdrwvyedwggiwigrlgkygvesprslkdakqdaywahhdlyllayalwptgffr
    lalpdqeemewfeanypgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrv
    sqvpfcpslakgastlrvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelse
    viaelhglrsdgktliaqphvrgdklwtlddikrlncvfknpvkafn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvgB (B:)
    raptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkder
    qfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkngy
    laqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgda
    vecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvsi
    andpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggiw
    igrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeanyp
    gwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastlr
    vheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktlia
    qphvrgdklwtlddikrlncvfknpvkafn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xvgC (C:)
    msmlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpna
    dwiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewryt
    drflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvsla
    fwgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfd
    wnesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyy
    nclgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvv
    ddwiedyasridfkadrdqivkavlaglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvgC (C:)
    smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
    wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
    rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
    wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
    nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
    clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
    dwiedyasridfkadrdqivkavlaglk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xvgD (D:)
    msmlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpna
    dwiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewryt
    drflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvsla
    fwgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfd
    wnesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyy
    nclgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvv
    ddwiedyasridfkadrdqivkavlaglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvgD (D:)
    smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
    wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
    rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
    wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
    nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
    clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
    dwiedyasridfkadrdqivkavlaglk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xvgE (E:)
    maklgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakl
    eekvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykp
    pimpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvgE (E:)
    klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
    kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
    mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xvgF (F:)
    maklgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakl
    eekvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykp
    pimpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvgF (F:)
    lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
    vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
    pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsp